PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN38739.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family TALE
Protein Properties Length: 767aa    MW: 85680 Da    PI: 7.3534
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN38739.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.82.1e-095575941954
                 HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 Fe   ++yp+ +++  LA+++gL+ +qV++WF N R +
  KHN38739.1 557 FEHflHPYPTDTDKHMLATQTGLSRNQVSNWFINARVR 594
                 665559******************************87 PP

2BELL104.48.1e-34412482272
        BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                 r e qk kakLl ++eeV +rYkqy++q+q+v+ sFe vagl  a+pY+slAlk +S+hFrcLk+ai++q+
  KHN38739.1 412 RPECQKNKAKLLYMQEEVTRRYKQYHQQMQMVVQSFESVAGLSLATPYVSLALKSVSKHFRCLKNAISDQL 482
                 5689****************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005744.2E-35299480IPR006563POX domain
PfamPF075269.7E-42304479IPR006563POX domain
PROSITE profilePS5007111.985535598IPR001356Homeobox domain
CDDcd000868.57E-11538599No hitNo description
SMARTSM003892.4E-8538602IPR001356Homeobox domain
SuperFamilySSF466897.7E-17540604IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.6E-27541602IPR009057Homeodomain-like
PfamPF059203.6E-18555594IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010076Biological Processmaintenance of floral meristem identity
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010223Biological Processsecondary shoot formation
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010229Biological Processinflorescence development
GO:0048645Biological Processorgan formation
GO:0080006Biological Processinternode patterning
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 767 aa     Download sequence    Send to blast
MSSLRPELHV AQQLRRDKLR IQNSSQQQHL QEFPNNLEQL SLQPGFNLDL LQVRSVRNGN  60
MLDEALYSSE MITFPNPLSA PRNPLECQEL MMVQYGSTSF PHSSSPKEQQ CEPRNLGASW  120
MLNYNNSSSS NNNNSNNSLY SSELNNNVSS EMANREIQKQ FGEMQYPPSS SSSSPIYHNA  180
LQDMAYGVWG GNNHHGESVL HYGNNELRIG GANLWTHNNN NIPLGFKKIN NDEQLHDRNH  240
THQGLSLSLS SNSKQQQSKP CFDEGSVVKS PSSTMKLNAL SNNNNNTVYR NVGPLGPFTG  300
YATILKSSRF LRPCQQLLDE WCCQSGSKFA KRGICDVPEW VSRDVSSAST CATALNVDES  360
AAKGGGNSGA SSSVLYCSIE NNNNNNNNNN NNNNNNNSAD GGAASSFCLS SRPECQKNKA  420
KLLYMQEEVT RRYKQYHQQM QMVVQSFESV AGLSLATPYV SLALKSVSKH FRCLKNAISD  480
QLKLTCEVLG EDFSIPTTST GSKFDNNMAR LRCMDQSFQK NKSGGANINF LEPQQHVWRP  540
QRGLPERSVA ILKAWLFEHF LHPYPTDTDK HMLATQTGLS RNQVSNWFIN ARVRVWKPMV  600
EEIHMLETKG VTTEARQHHQ TSSKNDQLAS ASEGSNNQPK SDNQPAHRFG GAHASHSHAI  660
PEKQFQCLEM GSSSSACNEE QIGMEEDQWN QEKRSKLDCQ ITTTTPSMDG TVMGFMPYRR  720
SGLEGLGSVS LTLGLRHGVE GVQQQQLQQE EELRRQFGGH MIYDFVG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A6e-15544602563Homeobox protein Meis2
3k2a_B6e-15544602563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150391e-133AP015039.1 Vigna angularis var. angularis DNA, chromosome 6, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006591130.10.0PREDICTED: BEL1-like homeodomain protein 8
TrEMBLA0A0B2S3450.0A0A0B2S345_GLYSO; BEL1-like homeodomain protein 8
STRINGGLYMA11G20240.30.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF34813257
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23760.32e-67BEL1-like homeodomain 4
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]